Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC29A3 Peptide - C-terminal region

SLC29A3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

ENT3, HJCD, PHID, HCLAP

UniProt

Q9BZD2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SLC29A3 Rabbit Polyclonal Antibody (orb579009) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

XP_016871866

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KALPGFVLLRTCLIPLFVLCNYQPRVHLKTVVFQSDVYPALLSSLLGLSN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Magic™ Human FGFR2 & BICC1 (L617V) BaF3 Cell Line
S01YF-1222-KX616 1 Vial

Magic™ Human FGFR2 & BICC1 (L617V) BaF3 Cell Line

Sign In for Pricing
View Details
ATF-6β Double Nickase Plasmid (h)
sc-405536-NIC 20 µg

ATF-6β Double Nickase Plasmid (h)

Sign In for Pricing
View Details
RM01 discontinued
541874-01 30ul

RM01 discontinued

Sign In for Pricing
View Details
RM01 discontinued
541874-02 100 µL

RM01 discontinued

Sign In for Pricing
View Details
Lentiviral human PLEKHG4B shRNA (UAS) - Lentiviral human PLEKHG4B shRNA (UAS, RFP) plasmid
GTR15333652 1 Vial

Lentiviral human PLEKHG4B shRNA (UAS) - Lentiviral human PLEKHG4B shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
RG9MTD2 sgRNA CRISPR Lentivector (Human) (Target 3)
K1814504 1.0 µg DNA

RG9MTD2 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details