Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC29A3 Peptide - C-terminal region

SLC29A3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

ENT3, HJCD, PHID, HCLAP

UniProt

Q9BZD2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SLC29A3 Rabbit Polyclonal Antibody (orb579009) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

XP_016871866

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KALPGFVLLRTCLIPLFVLCNYQPRVHLKTVVFQSDVYPALLSSLLGLSN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Difloxacin
526635 1.0g

Difloxacin

Sign In for Pricing
View Details
Fbxw9 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)
K6502706 1.0 µg DNA

Fbxw9 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
MAPK3 Antibody
E18-0562-1 50 µg - 50 µL

MAPK3 Antibody

Sign In for Pricing
View Details
Apc11 (ANAPC11) CytoSection
TS422619P5 25 Slides

Apc11 (ANAPC11) CytoSection

Sign In for Pricing
View Details
KOMBI 14 148X210MM SA POLYESTER B7541 Safety & Regulatory Compliance Signs & Labels (Adhesive)
251623 1 Card (1 Panel (s) x 1 Card)

KOMBI 14 148X210MM SA POLYESTER B7541 Safety & Regulatory Compliance Signs & Labels (Adhesive)

Sign In for Pricing
View Details
Azure A Eosinate
OR1023655-01 1 g

Azure A Eosinate

Sign In for Pricing
View Details