Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MBTPS2 Peptide - N-terminal region

MBTPS2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

S2P, IFAP, KFSD, KFSDX, OLMSX, BRESEK

UniProt

O43462

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MBTPS2 Rabbit Polyclonal Antibody (orb579979) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_056968

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VGGWTVVYLTDLVLKSSVYFKHSYEDWLENNGLSISPFHIRWQTAVFNRA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HLX Rabbit Polyclonal Antibody
orb583829 100 µL

HLX Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
EFNA5 Protein (C-His, Human)
P524072 100 µg

EFNA5 Protein (C-His, Human)

Sign In for Pricing
View Details
NOX3 ORF Vector (Human) (pORF)
ORF026189 1.0 µg DNA

NOX3 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Reagecon Total Acid Number (TAN) Standard 2.0 mg/g Potassium Hydroxide (KOH) in Synthetic Base Oil Matrix
RETAN20S 3x100g

Reagecon Total Acid Number (TAN) Standard 2.0 mg/g Potassium Hydroxide (KOH) in Synthetic Base Oil Matrix

Sign In for Pricing
View Details
Human Poly (A) Polymerase Gamma (PAPOLG) ELISA Kit
abx382049 96 Tests

Human Poly (A) Polymerase Gamma (PAPOLG) ELISA Kit

Sign In for Pricing
View Details
MD1 Polyclonal Antibody
MBS9237617-01 0.1 mL

MD1 Polyclonal Antibody

Sign In for Pricing
View Details