Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MBTPS2 Peptide - N-terminal region

MBTPS2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

S2P, IFAP, KFSD, KFSDX, OLMSX, BRESEK

UniProt

O43462

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MBTPS2 Rabbit Polyclonal Antibody (orb579979) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_056968

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VGGWTVVYLTDLVLKSSVYFKHSYEDWLENNGLSISPFHIRWQTAVFNRA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-IL-10/IL10 Antibody Fluoro488 Conjugated
A00021-4-Fluoro488 100 µg/Vial

Anti-IL-10/IL10 Antibody Fluoro488 Conjugated

Sign In for Pricing
View Details
TAOK1 Rabbit mAb
MBS4753459-01 0.1 mL

TAOK1 Rabbit mAb

Sign In for Pricing
View Details
TAOK1 Rabbit mAb
MBS4753459-02 5x 0.1 mL

TAOK1 Rabbit mAb

Sign In for Pricing
View Details
Recombinant Anti-Cytochrome c Rabbit mAb
MBS8326774-01 0.03 mL

Recombinant Anti-Cytochrome c Rabbit mAb

Sign In for Pricing
View Details
Recombinant Anti-Cytochrome c Rabbit mAb
MBS8326774-02 0.05 mL

Recombinant Anti-Cytochrome c Rabbit mAb

Sign In for Pricing
View Details
Recombinant Anti-Cytochrome c Rabbit mAb
MBS8326774-03 0.1 mL

Recombinant Anti-Cytochrome c Rabbit mAb

Sign In for Pricing
View Details