PCYOX1 Peptide - middle region
PCYOX1 Peptide - middle region
Product Specifications
Product Name Alternative
PCL1
UniProt
Q9UHG3
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_057381.3
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: INSIGIVPSVREKEDPEPSTDGTYVWKIFSQETLTKAQILKLFLSYDYAV
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6503917-01 0.2 mL
TPH1, NT (Tryptophan 5-hydroxylase 1, Tryptophan 5-monooxygenase 1, TRPH, TPRH, TPH) (PE)
Sign In for Pricing
View Details MBS6503917-02 5x 0.2 mL
TPH1, NT (Tryptophan 5-hydroxylase 1, Tryptophan 5-monooxygenase 1, TRPH, TPRH, TPH) (PE)
Sign In for Pricing
View Details bs-17389R-BF594 100 µL
HS2ST1 Polyclonal Antibody, AbBy Fluor™ 594 Conjugated
Sign In for Pricing
View Details 
033995-PE 200 µL
CLK2, ID (CLK2, Dual specificity protein kinase CLK2, CDC-like kinase 2) (PE) discontinued
Sign In for Pricing
View Details