What is the catalog number for PCYOX1 Peptide - middle region?

The catalog number for PCYOX1 Peptide - middle region is orb1999603.

What sizes are available for PCYOX1 Peptide - middle region?

PCYOX1 Peptide - middle region is available in the following size(s): 100 µg.

Is PCYOX1 Peptide - middle region in stock?

PCYOX1 Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

PCYOX1 Peptide - middle region

Product Specifications

Product Name Alternative

PCL1

UniProt

Q9UHG3

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_057381.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: INSIGIVPSVREKEDPEPSTDGTYVWKIFSQETLTKAQILKLFLSYDYAV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

E45R22753N 50 ul

GPR62 Rabbit pAb

Sign In for Pricing

View Details

C06263-100uL*2 2x 100μL

Trimethyl-Histone H3 (Lys 27) Mouse mAb

Sign In for Pricing

View Details

MBS1446788-01 0.02 mg (E-Coli)

Recombinant Alkalilimnicola ehrlichei Pantothenate synthetase (panC)

Sign In for Pricing

View Details

MBS1446788-02 0.02 mg (Yeast)

Recombinant Alkalilimnicola ehrlichei Pantothenate synthetase (panC)

Sign In for Pricing

View Details

MBS1446788-03 0.1 mg (E-Coli)

Recombinant Alkalilimnicola ehrlichei Pantothenate synthetase (panC)

Sign In for Pricing

View Details

MBS1446788-04 0.1 mg (Yeast)

Recombinant Alkalilimnicola ehrlichei Pantothenate synthetase (panC)

Sign In for Pricing

View Details