What is the catalog number for RANBP9 Peptide - middle region?

The catalog number for RANBP9 Peptide - middle region is orb1999602.

What sizes are available for RANBP9 Peptide - middle region?

RANBP9 Peptide - middle region is available in the following size(s): 100 µg.

Is RANBP9 Peptide - middle region in stock?

RANBP9 Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

RANBP9 Peptide - middle region

Product Specifications

Product Name Alternative

BPM-L, BPM90, RANBPM, RanBP7

UniProt

Q96S59

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_005484.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SHGMNIHNLASGKGSTAHFSGFESCSNGVISNKAHQSYCHSNKHQSSNLN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

E40KMPH3469 20 µg

Human PGC Protein, His Tag

Sign In for Pricing

View Details

E33P100526 10 µg

Mouse BTLA Protein, His Tag

Sign In for Pricing

View Details

sc-437076-NIC 20 µg

PLB Double Nickase Plasmid (m)

Sign In for Pricing

View Details

orb1080948 100 µL

Phospho-MYL12B (Thr19 + Ser20) Rabbit Polyclonal Antibody (RBITC)

Sign In for Pricing

View Details

sc-36470-PR 10 µM - 20 µL

SEMA3A (h) -PR

Sign In for Pricing

View Details

27977054 1.0 mL

MAML2 Adenovirus (Mouse)

Sign In for Pricing

View Details