Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RANBP9 Peptide - middle region

RANBP9 Peptide - middle region

Product Specifications

Product Name Alternative

BPM-L, BPM90, RANBPM, RanBP7

UniProt

Q96S59

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_005484.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SHGMNIHNLASGKGSTAHFSGFESCSNGVISNKAHQSYCHSNKHQSSNLN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Escherichia coli O9:H4 Octanoyltransferase (lipB)
MBS1097699-01 0.02 mg (E-Coli)

Recombinant Escherichia coli O9:H4 Octanoyltransferase (lipB)

Sign In for Pricing
View Details
Recombinant Escherichia coli O9:H4 Octanoyltransferase (lipB)
MBS1097699-02 0.1 mg (E-Coli)

Recombinant Escherichia coli O9:H4 Octanoyltransferase (lipB)

Sign In for Pricing
View Details
Recombinant Escherichia coli O9:H4 Octanoyltransferase (lipB)
MBS1097699-03 0.02 mg (Yeast)

Recombinant Escherichia coli O9:H4 Octanoyltransferase (lipB)

Sign In for Pricing
View Details
Recombinant Escherichia coli O9:H4 Octanoyltransferase (lipB)
MBS1097699-04 0.1 mg (Yeast)

Recombinant Escherichia coli O9:H4 Octanoyltransferase (lipB)

Sign In for Pricing
View Details
Recombinant Escherichia coli O9:H4 Octanoyltransferase (lipB)
MBS1097699-05 0.02 mg (Baculovirus)

Recombinant Escherichia coli O9:H4 Octanoyltransferase (lipB)

Sign In for Pricing
View Details
Recombinant Escherichia coli O9:H4 Octanoyltransferase (lipB)
MBS1097699-06 0.02 mg (Mammalian-Cell)

Recombinant Escherichia coli O9:H4 Octanoyltransferase (lipB)

Sign In for Pricing
View Details