What is the catalog number for NDUFAF1 Peptide - C-terminal region?

The catalog number for NDUFAF1 Peptide - C-terminal region is orb1999600.

What sizes are available for NDUFAF1 Peptide - C-terminal region?

NDUFAF1 Peptide - C-terminal region is available in the following size(s): 100 µg.

Is NDUFAF1 Peptide - C-terminal region in stock?

NDUFAF1 Peptide - C-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

NDUFAF1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CGI65, CIA30, CGI-65

UniProt

Q9Y375

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_057097.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DKISSIGFTLADKVDGPFFLEIDFIGVFTDPAHTEEFAYENSPELNPRLF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BF0160-01 50 µL

PTH Antibody

Sign In for Pricing

View Details

BF0160-02 100 µL

PTH Antibody

Sign In for Pricing

View Details

BF0160-03 200 µL

PTH Antibody

Sign In for Pricing

View Details

TRC-C430340-25MG 25 mg

4-((4-(7-Chloroquinolin-4-yl)piperazin-1-yl)sulfonyl)-3-nitroaniline

Sign In for Pricing

View Details

NBP2-99622AF647 0.1 mL

Rabbit Polyclonal Cerberus 1 Antibody [Alexa Fluor 647]

Sign In for Pricing

View Details

TA502104BM 100 µL

MYD88 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1B4]

Sign In for Pricing

View Details