NDUFAF1 Peptide - C-terminal region
NDUFAF1 Peptide - C-terminal region
Product Specifications
Product Name Alternative
CGI65, CIA30, CGI-65
UniProt
Q9Y375
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_057097.2
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: DKISSIGFTLADKVDGPFFLEIDFIGVFTDPAHTEEFAYENSPELNPRLF
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6183694-01 0.1 mL
SMAD2 (SMAD Family Member 2, JV18, JV18-1, MADH2, MADR2, MGC22139, MGC34440, hMAD-2, hSMAD2) (PE)
Sign In for Pricing
View Details MBS6183694-02 5x 0.1 mL
SMAD2 (SMAD Family Member 2, JV18, JV18-1, MADH2, MADR2, MGC22139, MGC34440, hMAD-2, hSMAD2) (PE)
Sign In for Pricing
View Details 
bs-2060R-PE-Cy5.5 100 µL
AQP9 Polyclonal Antibody, PE-Cy5.5 Conjugated
Sign In for Pricing
View Details 