What is the catalog number for RUSC1-AS1 Peptide - middle region?

The catalog number for RUSC1-AS1 Peptide - middle region is orb1999599.

What sizes are available for RUSC1-AS1 Peptide - middle region?

RUSC1-AS1 Peptide - middle region is available in the following size(s): 100 µg.

Is RUSC1-AS1 Peptide - middle region in stock?

RUSC1-AS1 Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

RUSC1-AS1 Peptide - middle region

Product Specifications

Product Name Alternative

C1orf104

UniProt

Q66K80

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001034606.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LWISEGGRGPGRGPGPEWTSRSLLPQSGPALQPTPYSQRKGPRETHPDAL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NBP2-97138UV 0.1 mL

Rabbit Polyclonal TR4/NR2C2 Antibody [DyLight 350]

Sign In for Pricing

View Details

RHN13701 100 μg

Anti-Kv6.4 K+ channel Antibody (N458/10)

Sign In for Pricing

View Details

MBS9323670-01 48 Well

Bovine N-acetyltransferase 14, NAT14 ELISA Kit

Sign In for Pricing

View Details

MBS9323670-02 96 Well

Bovine N-acetyltransferase 14, NAT14 ELISA Kit

Sign In for Pricing

View Details

MBS9323670-03 5x 96 Well

Bovine N-acetyltransferase 14, NAT14 ELISA Kit

Sign In for Pricing

View Details

MBS9323670-04 10x 96 Well

Bovine N-acetyltransferase 14, NAT14 ELISA Kit

Sign In for Pricing

View Details