RUSC1-AS1 Peptide - middle region
RUSC1-AS1 Peptide - middle region
Product Specifications
Product Name Alternative
C1orf104
UniProt
Q66K80
Field of Research
Neuroscience
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_001034606.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: LWISEGGRGPGRGPGPEWTSRSLLPQSGPALQPTPYSQRKGPRETHPDAL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTR15166858 1 Vial
Lentiviral mouse Snx17 shRNA (UAS) - Lentiviral mouse Snx17 shRNA (UAS, GFP) plasmid
Sign In for Pricing
View Details 
GTR15127000 1 Vial
Lentiviral human PPEF1 shRNA (UAS) - Lentiviral human PPEF1 shRNA (UAS, iRFP) plasmid
Sign In for Pricing
View Details 
MBS1016920-01 0.02 mg (E-Coli)
Recombinant Bacillus cereus Thiamine-phosphate synthase (thiE)
Sign In for Pricing
View Details MBS1016920-02 0.1 mg (E-Coli)
Recombinant Bacillus cereus Thiamine-phosphate synthase (thiE)
Sign In for Pricing
View Details MBS1016920-03 0.02 mg (Yeast)
Recombinant Bacillus cereus Thiamine-phosphate synthase (thiE)
Sign In for Pricing
View Details