Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAB11A Peptide - middle region

RAB11A Peptide - middle region

Product Specifications

Product Name Alternative

YL8

UniProt

P62491

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001193765.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TSALDSTNVEAAFQTILTEIYRIVSQKQMSDRRENDMSPSNNVVPIHVPP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GRPEL1, ID (GRPEL1, GREPEL1, GrpE protein homolog 1, mitochondrial, HMGE, Mt-GrpE#1) (MaxLight 750) discontinued
036318-ML750 100 µL

GRPEL1, ID (GRPEL1, GREPEL1, GrpE protein homolog 1, mitochondrial, HMGE, Mt-GrpE#1) (MaxLight 750) discontinued

Sign In for Pricing
View Details
Phenyl 3um 150 x 4.6mm - EACH
CHR4928 1 Each

Phenyl 3um 150 x 4.6mm - EACH

Sign In for Pricing
View Details
OR5AU1 Peptide - C-terminal region
orb2003589 100 µg

OR5AU1 Peptide - C-terminal region

Sign In for Pricing
View Details
Hsa-miR-6842-3p miRNA Inhibitor
orb1871157-01 10 nmol

Hsa-miR-6842-3p miRNA Inhibitor

Sign In for Pricing
View Details
Hsa-miR-6842-3p miRNA Inhibitor
orb1871157-02 20 nmol

Hsa-miR-6842-3p miRNA Inhibitor

Sign In for Pricing
View Details
Claudin-11 Polyclonal Antibody
JOT-AP01840-01 20 µL

Claudin-11 Polyclonal Antibody

Sign In for Pricing
View Details