Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CTNND1 Peptide - C-terminal region

CTNND1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CAS, p120, CTNND, P120CAS, P120CTN, p120 (CAS), p120 (CTN)

UniProt

O60716

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001078927.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IDRNQKSDKKPDREEIQMSNMGSNTKSLDNNYSTPNERGDHNRTLDRSGD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Ovary: left
CS631573 5x 5 µm

Frozen Tissue Sections, Ovary: left

Sign In for Pricing
View Details
Mucin 1 / EMA / Episialin / CD227 (MUC1/845), CF640R conjugate, 0.1mg/mL
BNC400845-500 1x 500 µL

Mucin 1 / EMA / Episialin / CD227 (MUC1/845), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
2-(2-Chlorophenoxy)ethyl Benzoate
TRC-C353860-100MG 100 mg

2-(2-Chlorophenoxy)ethyl Benzoate

Sign In for Pricing
View Details
Linalyl Acetate
TRC-L247045-500MG 500 mg

Linalyl Acetate

Sign In for Pricing
View Details
Sulbactam-d5 Sodium Salt (Major)
TRC-S699187-10MG 10 mg

Sulbactam-d5 Sodium Salt (Major)

Sign In for Pricing
View Details
p-Cresol-d7
TRC-C781902-10MG 10 mg

p-Cresol-d7

Sign In for Pricing
View Details