Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CTNND1 Peptide - C-terminal region

CTNND1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CAS, p120, CTNND, P120CAS, P120CTN, p120 (CAS), p120 (CTN)

UniProt

O60716

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001078927.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IDRNQKSDKKPDREEIQMSNMGSNTKSLDNNYSTPNERGDHNRTLDRSGD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SOX2 (76-80) Rabbit Polyclonal Antibody
AP26065PU-S 50 µL

SOX2 (76-80) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Cell Meter™ Live Cell Caspase 8 Binding Assay Kit *Red Fluorescence*
20116-AAT 25 Tests

Cell Meter™ Live Cell Caspase 8 Binding Assay Kit *Red Fluorescence*

Sign In for Pricing
View Details
MCAM Antibody
KC-3461-01 50 μL

MCAM Antibody

Sign In for Pricing
View Details
MCAM Antibody
KC-3461-02 100 µL

MCAM Antibody

Sign In for Pricing
View Details
MCAM Antibody
KC-3461-03 1 mL

MCAM Antibody

Sign In for Pricing
View Details
Lsm3 (NM_026309) Mouse Tagged ORF Clone
MG200330 10 µg

Lsm3 (NM_026309) Mouse Tagged ORF Clone

Sign In for Pricing
View Details