Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GPM6B Peptide - N-terminal region

GPM6B Peptide - N-terminal region

Product Specifications

Product Name Alternative

M6B

UniProt

Q13491

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001001994.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ETAAEENTEQSQERKGCFECCIKCLGGVPYASLVATILCFSGVALFCGCG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Smtn Rat shRNA Plasmid (Locus ID 289734)
TR701802 1 Kit

Smtn Rat shRNA Plasmid (Locus ID 289734)

Sign In for Pricing
View Details
TRIT1 Protein Vector (Mouse) (pPM-C-His)
PV241793 500 ng

TRIT1 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
Δ5 (10),6,8 (9) -D- (-) -Norgestrel
sc-477724 5 mg

Δ5 (10),6,8 (9) -D- (-) -Norgestrel

Sign In for Pricing
View Details
HOXA2 Antibody
A25446-100UG 100 µg

HOXA2 Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal ZNF596 Antibody
NBP2-49183-25ul 25 µL

Rabbit Polyclonal ZNF596 Antibody

Sign In for Pricing
View Details
TET1 (tet Oncogene 1, CXXC6, FLJ10839, FLJ41442, KIAA1676, LCX, bA119F7.1) (FITC)
MBS6178925-01 0.1 mL

TET1 (tet Oncogene 1, CXXC6, FLJ10839, FLJ41442, KIAA1676, LCX, bA119F7.1) (FITC)

Sign In for Pricing
View Details