Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GPM6B Peptide - N-terminal region

GPM6B Peptide - N-terminal region

Product Specifications

Product Name Alternative

M6B

UniProt

Q13491

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001001994.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ETAAEENTEQSQERKGCFECCIKCLGGVPYASLVATILCFSGVALFCGCG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse 5430427O19Rik shRNA (UAS) - Lentiviral mouse 5430427O19Rik shRNA (UAS) (25)
GTR15261857 1 Vial

Lentiviral mouse 5430427O19Rik shRNA (UAS) - Lentiviral mouse 5430427O19Rik shRNA (UAS) (25)

Sign In for Pricing
View Details
Recombinant Human ADGRG1 Protein
E30PQ522 20 µg

Recombinant Human ADGRG1 Protein

Sign In for Pricing
View Details
Biotin-Linked Anti-Enolase, Neuron Specific (NSE)
FY-AB43043-01 1 mL

Biotin-Linked Anti-Enolase, Neuron Specific (NSE)

Sign In for Pricing
View Details
Biotin-Linked Anti-Enolase, Neuron Specific (NSE)
FY-AB43043-02 100 µL

Biotin-Linked Anti-Enolase, Neuron Specific (NSE)

Sign In for Pricing
View Details
Biotin-Linked Anti-Enolase, Neuron Specific (NSE)
FY-AB43043-03 200 µL

Biotin-Linked Anti-Enolase, Neuron Specific (NSE)

Sign In for Pricing
View Details
Anti-PTGER1 Antibody
A06616 100 µL

Anti-PTGER1 Antibody

Sign In for Pricing
View Details