Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MRE11 Peptide - middle region

MRE11 Peptide - middle region

Product Specifications

Product Name Alternative

ATLD, HNGS1, MRE11A, MRE11B

UniProt

P49959

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_005581.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LGSIPDERLYRMFVNKKVTMLRPKEDENSWFNLFVIHQNRSKHGSTNFIP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Granzyme K Recombinant Rabbit monoclonal Antibody
HA751596 100 µL

Granzyme K Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Soft tissue
CS507956 5x 5 µm

Frozen Tissue Sections, Soft tissue

Sign In for Pricing
View Details
Frozen Tissue Blocks, Lung
CB523231 1 Block

Frozen Tissue Blocks, Lung

Sign In for Pricing
View Details
cis-tert-butyl 3-phenylaziridine-2-carboxylate
TRC-B490943-50MG 50 mg

cis-tert-butyl 3-phenylaziridine-2-carboxylate

Sign In for Pricing
View Details
N1,N12- Diacetylspermine Dihydrochloride
TRC-D367005-25MG 25 mg

N1,N12- Diacetylspermine Dihydrochloride

Sign In for Pricing
View Details
NPY1R Rabbit Polyclonal Antibody
AP01221PU-N 100 µg

NPY1R Rabbit Polyclonal Antibody

Sign In for Pricing
View Details