Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OSBP2 Peptide - C-terminal region

OSBP2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

HLM, ORP4, ORP-4, OSBPL1, OSBPL4

UniProt

Q969R2

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001269667.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MEKGRWDEANTEKQRLEEKQRLSRRRRLEACGPGSSCSSEEEKEADAYTP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RNF169 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K1840305 3x 1.0 µg

RNF169 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
APPL1 Peptide
orb1234424 0.1 mg

APPL1 Peptide

Sign In for Pricing
View Details
ZNF41 (Zinc Finger Protein 41, MGC8941, MRX89) (HRP)
MBS6179428-01 0.1 mL

ZNF41 (Zinc Finger Protein 41, MGC8941, MRX89) (HRP)

Sign In for Pricing
View Details
ZNF41 (Zinc Finger Protein 41, MGC8941, MRX89) (HRP)
MBS6179428-02 5x 0.1 mL

ZNF41 (Zinc Finger Protein 41, MGC8941, MRX89) (HRP)

Sign In for Pricing
View Details
Fast Follicle Stimulating Hormone α/FSHα Competitive ELISA, 1step and 1hr
TBS3281 96 Well Plate

Fast Follicle Stimulating Hormone α/FSHα Competitive ELISA, 1step and 1hr

Sign In for Pricing
View Details
Leukotriene B4 Receptor (BLTR) (FITC) discontinued
L2046-FITC 100 µL

Leukotriene B4 Receptor (BLTR) (FITC) discontinued

Sign In for Pricing
View Details