MEPE Peptide - C-terminal region
MEPE Peptide - C-terminal region
Product Specifications
Product Name Alternative
OF45
UniProt
Q9NQ76
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_001171623.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: VPHRQNNSTRNKGMPQGKGSWGRQPHSNRRFSSRRRDDSSESSDSGSSSE
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
bs-12914R-APC 100 µL
Phospho-c-Kit (Tyr730) Polyclonal Antibody, APC Conjugated
Sign In for Pricing
View Details 
MBS6283372-01 0.2 mL
CD68, ID (DKFZp686M18236, GP110, Macrophage Antigen CD68, Macrosialin, Scavenger Receptor Class D Member 1, SCARD1) (Azide free) (HRP)
Sign In for Pricing
View Details MBS6283372-02 5x 0.2 mL
CD68, ID (DKFZp686M18236, GP110, Macrophage Antigen CD68, Macrosialin, Scavenger Receptor Class D Member 1, SCARD1) (Azide free) (HRP)
Sign In for Pricing
View Details 