Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRMT5 Peptide - C-terminal region

TRMT5 Peptide - C-terminal region

Product Specifications

Product Name Alternative

TRM5, KIAA1393

UniProt

Q32P41

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_065861.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PNKEMLCITFQIPASVLYKNQTRNPENHEDPPLKRQRTAEAFSDEKTQIV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CTnT (25C11), mAb, Mouse
V00401-10 10 mg

CTnT (25C11), mAb, Mouse

Sign In for Pricing
View Details
PVDF (Hydrophobic)
MF025-45-PVDF 200 PCS/Box

PVDF (Hydrophobic)

Sign In for Pricing
View Details
Recombinant Clostridium Botulinum nrdR Protein (aa 1-151) (strain Okra / Type B1)
VAng-Lsx8373-1mgEcoli 1 mg (E. coli)

Recombinant Clostridium Botulinum nrdR Protein (aa 1-151) (strain Okra / Type B1)

Sign In for Pricing
View Details
Cat Angiotensin 2 (ANG2) ELISA Kit
YLA0164CT-01 48 Tests

Cat Angiotensin 2 (ANG2) ELISA Kit

Sign In for Pricing
View Details
Cat Angiotensin 2 (ANG2) ELISA Kit
YLA0164CT-02 96 Tests

Cat Angiotensin 2 (ANG2) ELISA Kit

Sign In for Pricing
View Details
Olr1490 Protein Vector (Rat) (pPM-C-HA)
33979026 500 ng

Olr1490 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details