Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRMT5 Peptide - C-terminal region

TRMT5 Peptide - C-terminal region

Product Specifications

Product Name Alternative

TRM5, KIAA1393

UniProt

Q32P41

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_065861.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PNKEMLCITFQIPASVLYKNQTRNPENHEDPPLKRQRTAEAFSDEKTQIV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ALKBH1 Human shRNA Plasmid Kit (Locus ID 8846)
TL314827 1 Kit

ALKBH1 Human shRNA Plasmid Kit (Locus ID 8846)

Sign In for Pricing
View Details
P Glycoprotein Rabbit pAb
E45R18627N-50 50 µL

P Glycoprotein Rabbit pAb

Sign In for Pricing
View Details
UFSP2 (NM_018359) Human Over-expression Lysate
LS055325 100 µg

UFSP2 (NM_018359) Human Over-expression Lysate

Sign In for Pricing
View Details
HER2 Blocking Peptide
CBP7191-01 1 mg

HER2 Blocking Peptide

Sign In for Pricing
View Details
HER2 Blocking Peptide
CBP7191-02 5 mg

HER2 Blocking Peptide

Sign In for Pricing
View Details
Kenposide B
MBS5781949 Inquire

Kenposide B

Sign In for Pricing
View Details