Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TSSC4 Peptide - middle region

TSSC4 Peptide - middle region

Product Specifications

UniProt

Q9Y5U2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_005697.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DLSLPGGAEVEALSPMGLPGEEDSGPDEPPSPPSGLLPATVQPFHLRGMS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Rpl29 activation kit by CRISPRa
GA203690 1 Kit

Mouse Rpl29 activation kit by CRISPRa

Sign In for Pricing
View Details
Mouse IL-10 (Interleukin 10) ELISA Kit
E-EL-M0046-01 24 Tests

Mouse IL-10 (Interleukin 10) ELISA Kit

Sign In for Pricing
View Details
Mouse IL-10 (Interleukin 10) ELISA Kit
E-EL-M0046-02 48 Tests

Mouse IL-10 (Interleukin 10) ELISA Kit

Sign In for Pricing
View Details
Mouse IL-10 (Interleukin 10) ELISA Kit
E-EL-M0046-03 96 Tests

Mouse IL-10 (Interleukin 10) ELISA Kit

Sign In for Pricing
View Details
Recombinant Sonic Hedgehog Antibody
RC-5019-01 50 μL

Recombinant Sonic Hedgehog Antibody

Sign In for Pricing
View Details
Recombinant Sonic Hedgehog Antibody
RC-5019-02 100 µL

Recombinant Sonic Hedgehog Antibody

Sign In for Pricing
View Details