Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TSSC4 Peptide - middle region

TSSC4 Peptide - middle region

Product Specifications

UniProt

Q9Y5U2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_005697.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DLSLPGGAEVEALSPMGLPGEEDSGPDEPPSPPSGLLPATVQPFHLRGMS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ADAMTS8 Rabbit Polyclonal Antibody
TA371757 100 µL

ADAMTS8 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SLC25A30 (NM_001010875) Human Over-expression Lysate
LY423200 100 µg

SLC25A30 (NM_001010875) Human Over-expression Lysate

Sign In for Pricing
View Details
CD35 / CR1 (CR1/802), CF405S conjugate, 0.1mg/mL
BNC040802-100 1x 100 µL

CD35 / CR1 (CR1/802), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MPS1 (RPS27) Mouse Monoclonal Antibody [Clone ID: 7E3]
AM06343SU-N 100 µL

MPS1 (RPS27) Mouse Monoclonal Antibody [Clone ID: 7E3]

Sign In for Pricing
View Details
TUBB2B Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2G1]
TA506696BM 100 µL

TUBB2B Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2G1]

Sign In for Pricing
View Details
Cyclin A2 (S- & G2-phase Cyclin) (CCNA2/2333), CF405S conjugate, 0.1mg/mL
BNC042333-500 1x 500 µL

Cyclin A2 (S- & G2-phase Cyclin) (CCNA2/2333), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details