Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ERG28 Peptide - C-terminal region

ERG28 Peptide - C-terminal region

Product Specifications

Product Name Alternative

NET51, C14orf1

UniProt

Q9UKR5

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_009107.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FLSELFVYGTAAPTIGVLAPLMVASFSILGMLVGLRYLEVEPVSRQKKRN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Kv4.2/KCND2 (Ab-616) Antibody
8B1088-AAT 50 µg

Kv4.2/KCND2 (Ab-616) Antibody

Sign In for Pricing
View Details
Human SLC30A7 activation kit by CRISPRa
GA115688 1 Kit

Human SLC30A7 activation kit by CRISPRa

Sign In for Pricing
View Details
CALmL5 (NM_017422) Human Recombinant Protein
TP304372 20 µg

CALmL5 (NM_017422) Human Recombinant Protein

Sign In for Pricing
View Details
Renal Cell Carcinoma (Carbonic Anhydrase IX) (66.4.C2), CF405S conjugate, 0.1mg/mL
BNC040287-100 1x 100 µL

Renal Cell Carcinoma (Carbonic Anhydrase IX) (66.4.C2), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ribonuclease A (RNase A), High Purity Grade, 250mg
PC0713-250mg 250 mg

Ribonuclease A (RNase A), High Purity Grade, 250mg

Sign In for Pricing
View Details
Recombinant Mouse IL-17D protein (N-His)
PKSM041506-01 20 µg

Recombinant Mouse IL-17D protein (N-His)

Sign In for Pricing
View Details