Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ERG28 Peptide - C-terminal region

ERG28 Peptide - C-terminal region

Product Specifications

Product Name Alternative

NET51, C14orf1

UniProt

Q9UKR5

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_009107.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FLSELFVYGTAAPTIGVLAPLMVASFSILGMLVGLRYLEVEPVSRQKKRN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PE/Cyanine7 Anti-Mouse CD31 Antibody[390]
E-AB-F1180UH-01 25 µg

PE/Cyanine7 Anti-Mouse CD31 Antibody[390]

Sign In for Pricing
View Details
PE/Cyanine7 Anti-Mouse CD31 Antibody[390]
E-AB-F1180UH-02 100 µg

PE/Cyanine7 Anti-Mouse CD31 Antibody[390]

Sign In for Pricing
View Details
Cefbuperazone
TRC-C242540-250MG 250 mg

Cefbuperazone

Sign In for Pricing
View Details
Bisacodyl
TRC-B400800-50MG 50 mg

Bisacodyl

Sign In for Pricing
View Details
IL1RA (IL1RN) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4E8]
TA803484BM 100 µL

IL1RA (IL1RN) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4E8]

Sign In for Pricing
View Details
CD137 / 4-1BB / TNFRSF9 (4-1BB/3201), CF568 conjugate, 0.1mg/mL
BNC683201-100 1x 100 µL

CD137 / 4-1BB / TNFRSF9 (4-1BB/3201), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details