CA5B Peptide - middle region
CA5B Peptide - middle region
Product Specifications
Product Name Alternative
CA-VB
UniProt
Q9Y2D0
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_009151.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: TLLFTSEGEKEKRMVDNFRPLQPLMNRTVRSSFRHDYVLNVQAKPKPATS
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTR15169964 1 Vial
Lentiviral mouse Cct2 shRNA (UAS) - Lentiviral mouseCct2 shRNA (UAS, GFP) (25)
Sign In for Pricing
View Details 
039706-HRP 200 µL
PAX7, CT (PAX7, HUP1, Paired box protein Pax-7, HuP1) (Azide free) (HRP) discontinued
Sign In for Pricing
View Details 
EK248078 96 Well
Human GCLC (Glutamate Cysteine Ligase, Catalytic) ELISA Kit
Sign In for Pricing
View Details QY-E10237 96 Tests
Rat Microtubule Associated Protein Tau (MAPt) ELISA kit
Sign In for Pricing
View Details