CA5B Peptide - middle region
CA5B Peptide - middle region
Product Specifications
Product Name Alternative
CA-VB
UniProt
Q9Y2D0
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_009151.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: TLLFTSEGEKEKRMVDNFRPLQPLMNRTVRSSFRHDYVLNVQAKPKPATS
More Discoveries
Explore Other Products
Browse additional items from our catalog
![8-Chloro-6- (O-Fluorophenyl) -1-Methyl-4H-Imidazo[1,5-a][1,4]Benzodiazepine-3-Carboxylic Acid](https://cdn.genprice.uk/genprice/uk/genprice4.webp)
FC101763-01 1 mg
8-Chloro-6- (O-Fluorophenyl) -1-Methyl-4H-Imidazo[1,5-a][1,4]Benzodiazepine-3-Carboxylic Acid
Sign In for Pricing
View Details ![8-Chloro-6- (O-Fluorophenyl) -1-Methyl-4H-Imidazo[1,5-a][1,4]Benzodiazepine-3-Carboxylic Acid](https://cdn.genprice.uk/genprice/uk/genprice2.webp)
FC101763-02 2 mg
8-Chloro-6- (O-Fluorophenyl) -1-Methyl-4H-Imidazo[1,5-a][1,4]Benzodiazepine-3-Carboxylic Acid
Sign In for Pricing
View Details FC101763-03 5 mg
8-Chloro-6- (O-Fluorophenyl) -1-Methyl-4H-Imidazo[1,5-a][1,4]Benzodiazepine-3-Carboxylic Acid
Sign In for Pricing
View Details FC101763-04 10 mg
8-Chloro-6- (O-Fluorophenyl) -1-Methyl-4H-Imidazo[1,5-a][1,4]Benzodiazepine-3-Carboxylic Acid
Sign In for Pricing
View Details FC101763-05 25 mg
8-Chloro-6- (O-Fluorophenyl) -1-Methyl-4H-Imidazo[1,5-a][1,4]Benzodiazepine-3-Carboxylic Acid
Sign In for Pricing
View Details 428971 100 mg
4- (4- (4,4,5,5-Tetramethyl-1,3,2-dioxaborolan-2-yl) cyclohex-3-en-1-yl) -1,4-oxazepane
Sign In for Pricing
View Details