CEP68 Peptide - middle region
CEP68 Peptide - middle region
Product Specifications
Product Name Alternative
KIAA0582
UniProt
Q8TAP6
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_001258918.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: EAFVCVGTKAKGVPHAWVMTCGTDGAITFWESLTGHRYIHKPTNPDEPPV
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS1115358 Inquire
Recombinant Serpentine receptor class beta-11 (srb-11)
Sign In for Pricing
View Details 
MBS7213891-01 48 Well
Bovine Ectonucleoside triphosphate diphosphohydrolase 1 (ENTPD1) ELISA Kit
Sign In for Pricing
View Details MBS7213891-02 96 Well
Bovine Ectonucleoside triphosphate diphosphohydrolase 1 (ENTPD1) ELISA Kit
Sign In for Pricing
View Details MBS7213891-03 5x 96 Well
Bovine Ectonucleoside triphosphate diphosphohydrolase 1 (ENTPD1) ELISA Kit
Sign In for Pricing
View Details MBS7213891-04 10x 96 Well
Bovine Ectonucleoside triphosphate diphosphohydrolase 1 (ENTPD1) ELISA Kit
Sign In for Pricing
View Details NC1-H5223-100ug 100 µg
Human NCAM-1 / CD56 Protein, His Tag (MALS verified)
Sign In for Pricing
View Details