What is the catalog number for CEP68 Peptide - middle region?

The catalog number for CEP68 Peptide - middle region is orb1999573.

What sizes are available for CEP68 Peptide - middle region?

CEP68 Peptide - middle region is available in the following size(s): 100 µg.

Is CEP68 Peptide - middle region in stock?

CEP68 Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

CEP68 Peptide - middle region

Product Specifications

Product Name Alternative

KIAA0582

UniProt

Q8TAP6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001258918.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EAFVCVGTKAKGVPHAWVMTCGTDGAITFWESLTGHRYIHKPTNPDEPPV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

sc-415361-HDR 20 µg

ZNF547 HDR Plasmid (h)

Sign In for Pricing

View Details

orb1320488-01 30 µL

MUT Antibody

Sign In for Pricing

View Details

orb1320488-02 50 μL

MUT Antibody

Sign In for Pricing

View Details

orb1320488-03 100 µL

MUT Antibody

Sign In for Pricing

View Details

MBS1193347-01 0.02 mg (E-Coli)

Recombinant Mycobacterium vanbaalenii Adenosine deaminase (add)

Sign In for Pricing

View Details

MBS1193347-02 0.02 mg (Yeast)

Recombinant Mycobacterium vanbaalenii Adenosine deaminase (add)

Sign In for Pricing

View Details