Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SOD3 Peptide - N-terminal region

SOD3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

EC-SOD

UniProt

P08294

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_003093.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LAAGASDAWTGEDSAEPNSDSAEWIRDMYAKVTEIWQEVMQRRDDDGALH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SERPING1 Protein Vector (Mouse) (pPM-C-HA)
43504024 500 ng

SERPING1 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Olfr187 Recombinant Protein (Mouse)
RP157301 100 µg

Olfr187 Recombinant Protein (Mouse)

Sign In for Pricing
View Details
2- (5-Bromo-2-methoxypyridin-3-yl) acetic acid
CZB59320-01 50 mg

2- (5-Bromo-2-methoxypyridin-3-yl) acetic acid

Sign In for Pricing
View Details
2- (5-Bromo-2-methoxypyridin-3-yl) acetic acid
CZB59320-02 0.5 g

2- (5-Bromo-2-methoxypyridin-3-yl) acetic acid

Sign In for Pricing
View Details
Rabbit Polyclonal TTLL5 Antibody [FITC]
NBP2-32086F 0.1 mL

Rabbit Polyclonal TTLL5 Antibody [FITC]

Sign In for Pricing
View Details
Lentiviral human PDZD8 shRNA (UAS) - Lentiviral human PDZD8 shRNA (UAS, GFP) (100)
GTR15346836 1 Vial

Lentiviral human PDZD8 shRNA (UAS) - Lentiviral human PDZD8 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details