Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GAP43 Peptide - N-terminal region

GAP43 Peptide - N-terminal region

Product Specifications

Product Name Alternative

B-50, PP46

UniProt

P17677

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001123536.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VEKNDDDQKIEQDGIKPEDKAHKAATKIQASFRGHITRKKLKGEKKDDVQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Myosin Phosphatase 2 (PPP1R12B) Human Gene Knockout Kit (CRISPR)
KN417905 1 Kit

Myosin Phosphatase 2 (PPP1R12B) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD4 (T-Helper/Inducer Cell Marker) (RIV7), CF568 conjugate, 0.1mg/mL
BNC680362-100 1x 100 µL

CD4 (T-Helper/Inducer Cell Marker) (RIV7), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human RUNDC1 activation kit by CRISPRa
GA115591 1 Kit

Human RUNDC1 activation kit by CRISPRa

Sign In for Pricing
View Details
p38 (MAPK14) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5A6]
TA813282AM 100 µL

p38 (MAPK14) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5A6]

Sign In for Pricing
View Details
Human C17orf50 activation kit by CRISPRa
GA115585 1 Kit

Human C17orf50 activation kit by CRISPRa

Sign In for Pricing
View Details
Recombinant CD1C Antibody
RC-16320-01 50 μL

Recombinant CD1C Antibody

Sign In for Pricing
View Details