Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GAP43 Peptide - N-terminal region

GAP43 Peptide - N-terminal region

Product Specifications

Product Name Alternative

B-50, PP46

UniProt

P17677

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001123536.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VEKNDDDQKIEQDGIKPEDKAHKAATKIQASFRGHITRKKLKGEKKDDVQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fluorescein-5-Maleimide
#91028 1x 25 mg

Fluorescein-5-Maleimide

Sign In for Pricing
View Details
MAP3K15 (NM_001001671) Human Over-expression Lysate
LC400363 20 µg

MAP3K15 (NM_001001671) Human Over-expression Lysate

Sign In for Pricing
View Details
Human ANG1 (Angiopoietin 1) ELISA Kit
E-EL-H6119-01 24 Tests

Human ANG1 (Angiopoietin 1) ELISA Kit

Sign In for Pricing
View Details
Human ANG1 (Angiopoietin 1) ELISA Kit
E-EL-H6119-02 48 Tests

Human ANG1 (Angiopoietin 1) ELISA Kit

Sign In for Pricing
View Details
Human ANG1 (Angiopoietin 1) ELISA Kit
E-EL-H6119-03 96 Tests

Human ANG1 (Angiopoietin 1) ELISA Kit

Sign In for Pricing
View Details
Human GNG13 activation kit by CRISPRa
GA109983 1 Kit

Human GNG13 activation kit by CRISPRa

Sign In for Pricing
View Details