Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FEN1 Peptide - C-terminal region

FEN1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MF1, RAD2, FEN-1

UniProt

P39748

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_004102.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FSEERIRSGVKRLSKSRQGSTQGRLDDFFKVTGSLSSAKRKEPEPKGSTK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Prostate
CS702384 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
UNC5D Human Gene Knockout Kit (CRISPR)
KN423198 1 Kit

UNC5D Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant Human CCL8/MCP-2 Protein
PKSH033731-01 10 µg

Recombinant Human CCL8/MCP-2 Protein

Sign In for Pricing
View Details
Recombinant Human CCL8/MCP-2 Protein
PKSH033731-02 50 µg

Recombinant Human CCL8/MCP-2 Protein

Sign In for Pricing
View Details
GFAP (Astrocyte & Neural Stem Cell Marker) (ASTRO/1974R), CF488A conjugate, 0.1mg/mL
BNC881974-500 1x 500 µL

GFAP (Astrocyte & Neural Stem Cell Marker) (ASTRO/1974R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CTNNA3 (NM_001127384) Human Over-expression Lysate
LY426767 100 µg

CTNNA3 (NM_001127384) Human Over-expression Lysate

Sign In for Pricing
View Details