Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FEN1 Peptide - C-terminal region

FEN1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MF1, RAD2, FEN-1

UniProt

P39748

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_004102.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FSEERIRSGVKRLSKSRQGSTQGRLDDFFKVTGSLSSAKRKEPEPKGSTK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MED19 Mouse Monoclonal Antibody [Clone ID: OTI2E6]
CF810429 100 µg

MED19 Mouse Monoclonal Antibody [Clone ID: OTI2E6]

Sign In for Pricing
View Details
Tropomyosin 3 (TPM3) (NM_152263) Human Recombinant Protein
TP303276 20 µg

Tropomyosin 3 (TPM3) (NM_152263) Human Recombinant Protein

Sign In for Pricing
View Details
3-Maleimidopropionic Acid N-Succinimidyl Ester
TRC-M141000-5G 5 g

3-Maleimidopropionic Acid N-Succinimidyl Ester

Sign In for Pricing
View Details
VASP Rabbit Polyclonal Antibody
TA383198 100 µL

VASP Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ENPP7 Antibody
KC-7374-01 50 μL

ENPP7 Antibody

Sign In for Pricing
View Details
ENPP7 Antibody
KC-7374-02 100 µL

ENPP7 Antibody

Sign In for Pricing
View Details