Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FEN1 Peptide - C-terminal region

FEN1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MF1, RAD2, FEN-1

UniProt

P39748

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_004102.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EERIRSGVKRLSKSRQGSTQGRLDDFFKVTGSLSSAKRKEPEPKGSTKKK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RBMXL1 Human Gene Knockout Kit (CRISPR)
KN402165 1 Kit

RBMXL1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ARH3 (ADPRHL2) (NM_017825) Human Over-expression Lysate
LY402619 100 µg

ARH3 (ADPRHL2) (NM_017825) Human Over-expression Lysate

Sign In for Pricing
View Details
BNP (NPPB) (NM_002521) Human Over-expression Lysate
LC400900 20 µg

BNP (NPPB) (NM_002521) Human Over-expression Lysate

Sign In for Pricing
View Details
HSP70-1A (HSPA1A) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5F3]
TA500770AM 100 µL

HSP70-1A (HSPA1A) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5F3]

Sign In for Pricing
View Details
TM9SF1 (NM_006405) Human Over-expression Lysate
LC401926 20 µg

TM9SF1 (NM_006405) Human Over-expression Lysate

Sign In for Pricing
View Details
Velpatasvir
TRC-V116000-25MG 25 mg

Velpatasvir

Sign In for Pricing
View Details