Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FEN1 Peptide - C-terminal region

FEN1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MF1, RAD2, FEN-1

UniProt

P39748

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_004102.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EERIRSGVKRLSKSRQGSTQGRLDDFFKVTGSLSSAKRKEPEPKGSTKKK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2610002M06Rik (NM_025921) Mouse Tagged ORF Clone
MG201997 10 µg

2610002M06Rik (NM_025921) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
CMIP Rabbit Polyclonal Antibody
TA374909 100 µL

CMIP Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Aldicarb Sulfone
TRC-A514660-50MG 50 mg

Aldicarb Sulfone

Sign In for Pricing
View Details
Frozen Tissue Sections, Kidney
CS639711 5x 5 µm

Frozen Tissue Sections, Kidney

Sign In for Pricing
View Details
HER-2 / c-erbB-2 / neu / CD340 (ERBB2/3257), CF640R conjugate, 0.1mg/mL
BNC403257-100 1x 100 µL

HER-2 / c-erbB-2 / neu / CD340 (ERBB2/3257), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
4930519N16Rik (BC016199) Mouse Tagged ORF Clone
MG200312 10 µg

4930519N16Rik (BC016199) Mouse Tagged ORF Clone

Sign In for Pricing
View Details