Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ATP1A2 Peptide - N-terminal region

ATP1A2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

FHM2, MHP2

UniProt

P50993

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_000693.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: REYSPAATTAENGGGKKKQKEKELDELKKEVAMDDHKLSLDELGRKYQVD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bovine Vitamin E,VE ELISA Kit
CELI-66055b 96 Tests

Bovine Vitamin E,VE ELISA Kit

Sign In for Pricing
View Details
Lentiviral human PIK3AP1 shRNA (UAS) - Lentiviral human PIK3AP1 shRNA (UAS, RFP) (100)
GTR15341751 1 Vial

Lentiviral human PIK3AP1 shRNA (UAS) - Lentiviral human PIK3AP1 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
HSNF2H (D-10) Alexa Fluor® 790
sc-365727 AF790 200 µg/mL

HSNF2H (D-10) Alexa Fluor® 790

Sign In for Pricing
View Details
PHKG1P1 3'UTR GFP Stable Cell Line
TU067883 1.0 mL

PHKG1P1 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
C21orf128 3'UTR Luciferase Stable Cell Line
TU003293 1.0 mL

C21orf128 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Goose UPF0472 Protein C16orf72 (C16ORF72) ELISA Kit
MBS9930302 Inquire

Goose UPF0472 Protein C16orf72 (C16ORF72) ELISA Kit

Sign In for Pricing
View Details