Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PSMC6 Peptide - middle region

PSMC6 Peptide - middle region

Product Specifications

Product Name Alternative

P44, p42, SUG2, CADP44, HEL-S-73

UniProt

P62333

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_002797.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VDPLVYNMSHEDPGNVSYSEIGGLSEQIRELREVIELPLTNPELFQRVGI

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-MARK3 Antibody, Affinity Purified
A302-186A-T 2 µg

Rabbit anti-MARK3 Antibody, Affinity Purified

Sign In for Pricing
View Details
E1 (NC_014952) Virus Tagged ORF Clone
VC101857 10 µg

E1 (NC_014952) Virus Tagged ORF Clone

Sign In for Pricing
View Details
Human Stem Cell Factor (SCF) ELISA Kit
orb1663672-01 48 Tests

Human Stem Cell Factor (SCF) ELISA Kit

Sign In for Pricing
View Details
Human Stem Cell Factor (SCF) ELISA Kit
orb1663672-02 96 Tests

Human Stem Cell Factor (SCF) ELISA Kit

Sign In for Pricing
View Details
GATA-1 Monoclonal Antibody
RA11283-01 50 µL

GATA-1 Monoclonal Antibody

Sign In for Pricing
View Details
GATA-1 Monoclonal Antibody
RA11283-02 100 µL

GATA-1 Monoclonal Antibody

Sign In for Pricing
View Details