What is the catalog number for PSMC6 Peptide - middle region?

The catalog number for PSMC6 Peptide - middle region is orb1999562.

What sizes are available for PSMC6 Peptide - middle region?

PSMC6 Peptide - middle region is available in the following size(s): 100 µg.

Is PSMC6 Peptide - middle region in stock?

PSMC6 Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

PSMC6 Peptide - middle region

Product Specifications

Product Name Alternative

P44, p42, SUG2, CADP44, HEL-S-73

UniProt

P62333

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_002797.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VDPLVYNMSHEDPGNVSYSEIGGLSEQIRELREVIELPLTNPELFQRVGI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

sc-420649-LAC 200 µL

GPI-PLD Lentiviral Activation Particles (m)

Sign In for Pricing

View Details

17902024 500 ng

DEFA5 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing

View Details

MBS6472013-01 0.2 mL

DCT, NT (Tyrosinase-related Protein 2, TRP-2, TRP2, L-dopachrome Delta-isomerase, L-dopachrome Tautomerase, DT, TYRP2) (Azide free) (HRP)

Sign In for Pricing

View Details

MBS6472013-02 5x 0.2 mL

DCT, NT (Tyrosinase-related Protein 2, TRP-2, TRP2, L-dopachrome Delta-isomerase, L-dopachrome Tautomerase, DT, TYRP2) (Azide free) (HRP)

Sign In for Pricing

View Details

CRN2990-01 15 nmol

ZNF32 siRNA (Mouse)

Sign In for Pricing

View Details

CRN2990-02 30 nmol

ZNF32 siRNA (Mouse)

Sign In for Pricing

View Details