Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CPNE3 Peptide - middle region

CPNE3 Peptide - middle region

Product Specifications

Product Name Alternative

CPN3, PRO1071

UniProt

Q9NVH1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_060668.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EEFERLQREREERRLQQRTNPKGTISVGVDATDLFDRYDEEYEDVSGSSF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Repin1 shRNA (UAS) - Lentiviral mouse Repin1 shRNA (UAS, GFP) plasmid
GTR15290050 1 Vial

Lentiviral mouse Repin1 shRNA (UAS) - Lentiviral mouse Repin1 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
Rpa1 3'UTR Luciferase Stable Cell Line
TU219595 1.0 mL

Rpa1 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Vinculin Rabbit mAb
C05002-100ul 100 µL

Vinculin Rabbit mAb

Sign In for Pricing
View Details
Olfr358 3'UTR Lenti-reporter-Luc Vector
33097084 1.0 µg

Olfr358 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Polystyrene C4 Br
HB04508001.5G 5 g

Polystyrene C4 Br

Sign In for Pricing
View Details
ARHF Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
12275061 1.0 µg DNA

ARHF Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details