CPNE3 Peptide - middle region
CPNE3 Peptide - middle region
Product Specifications
Product Name Alternative
CPN3, PRO1071
UniProt
Q9NVH1
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_060668.2
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: EEFERLQREREERRLQQRTNPKGTISVGVDATDLFDRYDEEYEDVSGSSF
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
336926-01 50 µg
TFAM (Transcription Factor A, Mitochondrial, mtTFA, Mitochondrial Transcription Factor 1, MtTF1, Transcription Factor 6, TCF-6, Transcription Factor 6-like 2, TFAM, TCF6, TCF6L20) (FITC)
Sign In for Pricing
View Details 336926-02 100 µg
TFAM (Transcription Factor A, Mitochondrial, mtTFA, Mitochondrial Transcription Factor 1, MtTF1, Transcription Factor 6, TCF-6, Transcription Factor 6-like 2, TFAM, TCF6, TCF6L20) (FITC)
Sign In for Pricing
View Details MBS6141497-01 0.1 mL
DDOST (Dolichyl-diphosphooligosaccharide-Protein Glycosyltransferase 48kD Subunit, Oligosaccharyl Transferase 48kD Subunit, DDOST 48kD Subunit, KIAA0115, OST48, OK/SW-cl.45) (Biotin)
Sign In for Pricing
View Details