Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EPN3 Peptide - middle region

EPN3 Peptide - middle region

Product Specifications

UniProt

Q9H201

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_060427.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TETKEGLEQALPSGKPSSPVELDLFGDPSPSSKQNGTKEPDALDLGILGE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SARS-CoV-2 Spike RBD Alexa Fluor 488 MAb (Cl 2847A)
FAB11198G-100UG 100 µg

SARS-CoV-2 Spike RBD Alexa Fluor 488 MAb (Cl 2847A)

Sign In for Pricing
View Details
NKX2-5 Rabbit pAb
E45R25981N-100 100 µL

NKX2-5 Rabbit pAb

Sign In for Pricing
View Details
Bovine Total Smad 2 ELISA Kit
MBS019614-01 48 Well

Bovine Total Smad 2 ELISA Kit

Sign In for Pricing
View Details
Bovine Total Smad 2 ELISA Kit
MBS019614-02 96 Well

Bovine Total Smad 2 ELISA Kit

Sign In for Pricing
View Details
Bovine Total Smad 2 ELISA Kit
MBS019614-03 5x 96 Well

Bovine Total Smad 2 ELISA Kit

Sign In for Pricing
View Details
Bovine Total Smad 2 ELISA Kit
MBS019614-04 10x 96 Well

Bovine Total Smad 2 ELISA Kit

Sign In for Pricing
View Details