What is the catalog number for EPN3 Peptide - middle region?

The catalog number for EPN3 Peptide - middle region is orb1999559.

What sizes are available for EPN3 Peptide - middle region?

EPN3 Peptide - middle region is available in the following size(s): 100 µg.

Is EPN3 Peptide - middle region in stock?

EPN3 Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

EPN3 Peptide - middle region

Product Specifications

UniProt

Q9H201

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_060427.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TETKEGLEQALPSGKPSSPVELDLFGDPSPSSKQNGTKEPDALDLGILGE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MR205488A1V 250 µL

Mouse Gnaq (NM_008139) AAV Particle

Sign In for Pricing

View Details

sc-402074-HDR 20 µg

SGLT-2 HDR Plasmid (h)

Sign In for Pricing

View Details

17173066 1.0 µg DNA

CXCL17 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing

View Details

abx166147-01 10 µg

Rat Regenerating Islet Derived Protein 4 (REG4) Protein

Sign In for Pricing

View Details

abx166147-02 50 µg

Rat Regenerating Islet Derived Protein 4 (REG4) Protein

Sign In for Pricing

View Details

abx166147-03 100 µg

Rat Regenerating Islet Derived Protein 4 (REG4) Protein

Sign In for Pricing

View Details