GPATCH2 Peptide - middle region
GPATCH2 Peptide - middle region
Product Specifications
Product Name Alternative
CT110, GPATC2, PPP1R30
UniProt
Q9NW75
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_060510.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: SSLEEPSKDYRENHNNNKKDHSDSDDQMLVAKRRPSSNLNNNVRGKRPLW
More Discoveries
Explore Other Products
Browse additional items from our catalog
249165 50 µL
NCKIPSD (NCK Interacting Protein with SH3 Domain, AF3P21, DIP, DIP1, MGC23891, ORF1, SPIN90, WASLBP, WISH)
Sign In for Pricing
View Details 
B-M3-25-B5 20 Mounts/Base Assemblies
MicroMesh Assembly; box of 20 assemblies
Sign In for Pricing
View Details