What is the catalog number for METTL5 Peptide - middle region?

The catalog number for METTL5 Peptide - middle region is orb1999553.

What sizes are available for METTL5 Peptide - middle region?

METTL5 Peptide - middle region is available in the following size(s): 100 µg.

Is METTL5 Peptide - middle region in stock?

METTL5 Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

METTL5 Peptide - middle region

Product Specifications

Product Name Alternative

HSPC133

UniProt

Q9NRN9

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_054887.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RNAEEFELTNIDMVQCDVCLLSNRMSKSFDTVIMNPPFGTKNNKGTDMAF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NBP2-90156AF488 0.1 mL

Rabbit Monoclonal P-Selectin/CD62P Antibody (001) [Alexa Fluor 488]

Sign In for Pricing

View Details

orb1915376-01 10 nmol

Hsa-miR-3147 miRNA Antagomir

Sign In for Pricing

View Details

orb1915376-02 20 nmol

Hsa-miR-3147 miRNA Antagomir

Sign In for Pricing

View Details

NBP1-53158 100 µL

Rabbit Polyclonal TOE1 Antibody

Sign In for Pricing

View Details

bs-23393R-PE-Cy5 100 µL

GCLC Polyclonal Antibody, PE-Cy5 Conjugated

Sign In for Pricing

View Details

MBS1273534-01 0.01 mg Plasmid + 0.2 mL Glycerol-Stock

ALG9 cDNA Clone

Sign In for Pricing

View Details