Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

METTL5 Peptide - middle region

METTL5 Peptide - middle region

Product Specifications

Product Name Alternative

HSPC133

UniProt

Q9NRN9

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_054887.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RNAEEFELTNIDMVQCDVCLLSNRMSKSFDTVIMNPPFGTKNNKGTDMAF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-Ephrin B (Ser300) Polyclonal Antibody, RBITC Conjugated
bs-3128R-RBITC 100 µL

Phospho-Ephrin B (Ser300) Polyclonal Antibody, RBITC Conjugated

Sign In for Pricing
View Details
DGKH (NM_001204506) Human Tagged ORF Clone
RG233198 10 µg

DGKH (NM_001204506) Human Tagged ORF Clone

Sign In for Pricing
View Details
Anti-EIF1AY  (1B4)
YF-MA16648 100 ug

Anti-EIF1AY (1B4)

Sign In for Pricing
View Details
Anti-TDP2/ EAPII Antibody Clone TDP2/1258, Unconjugated-100ug
51567-MSM1-P1 100ug

Anti-TDP2/ EAPII Antibody Clone TDP2/1258, Unconjugated-100ug

Sign In for Pricing
View Details
Mouse ASZ1 shRNA Plasmid
abx978074-01 150 µg

Mouse ASZ1 shRNA Plasmid

Sign In for Pricing
View Details
Mouse ASZ1 shRNA Plasmid
abx978074-02 300 µg

Mouse ASZ1 shRNA Plasmid

Sign In for Pricing
View Details