Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TAGLN2 Peptide - middle region

TAGLN2 Peptide - middle region

Product Specifications

Product Name Alternative

HA1756

UniProt

P37802

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001264152.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NWFPKKSKENPRNFSDNQLQEGKNVIGLQMGTNRGASQAGMTGYGMPRQI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytochrome P450 3A43 Antibody
8C12274-AAT 50 µg

Cytochrome P450 3A43 Antibody

Sign In for Pricing
View Details
Human CEECAM1 (CERCAM) activation kit by CRISPRa
GA109606 1 Kit

Human CEECAM1 (CERCAM) activation kit by CRISPRa

Sign In for Pricing
View Details
Tmem97 (BC018156) Mouse Tagged ORF Clone
MG201535 10 µg

Tmem97 (BC018156) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
SMEK2 (PPP4R3B) (NM_001122964) Human Over-expression Lysate
LY426590 100 µg

SMEK2 (PPP4R3B) (NM_001122964) Human Over-expression Lysate

Sign In for Pricing
View Details
Frozen Tissue Blocks, Muscle tissue
CB526594 1 Block

Frozen Tissue Blocks, Muscle tissue

Sign In for Pricing
View Details
Recombinant Human SCGN/Secretagogin Protein (Human Cells, His Tag)
PKSH033536-01 10 µg

Recombinant Human SCGN/Secretagogin Protein (Human Cells, His Tag)

Sign In for Pricing
View Details