Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TAGLN2 Peptide - middle region

TAGLN2 Peptide - middle region

Product Specifications

Product Name Alternative

HA1756

UniProt

P37802

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001264152.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NWFPKKSKENPRNFSDNQLQEGKNVIGLQMGTNRGASQAGMTGYGMPRQI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RIPPLY2 (NM_001009994) Human Recombinant Protein
TP320725L 1 mg

RIPPLY2 (NM_001009994) Human Recombinant Protein

Sign In for Pricing
View Details
Lauroylcholine Chloride
TRC-L185000-5G 5 g

Lauroylcholine Chloride

Sign In for Pricing
View Details
Diacetyl Phloroglucinol
TRC-D365505-250MG 250 mg

Diacetyl Phloroglucinol

Sign In for Pricing
View Details
P57 / KIP2 (KP10), CF594 conjugate, 0.1mg/mL
BNC940879-500 1x 500 µL

P57 / KIP2 (KP10), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cibenzoline
TRC-C535723-5MG 5 mg

Cibenzoline

Sign In for Pricing
View Details
SPACA1 Rabbit Polyclonal Antibody
TA366474 100 µL

SPACA1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details