Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SH2D4A Peptide - N-terminal region

SH2D4A Peptide - N-terminal region

Product Specifications

Product Name Alternative

SH2A, PPP1R38

UniProt

Q9H788

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001167630.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KESLPVKPRPKKENGKSVHWKLGADKEVWVWVMGEHHLDKPYDVLCNEII

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Idarubicin Impurity 21
RM-I041821-01 10 mg

Idarubicin Impurity 21

Sign In for Pricing
View Details
Idarubicin Impurity 21
RM-I041821-02 100 mg

Idarubicin Impurity 21

Sign In for Pricing
View Details
Idarubicin Impurity 21
RM-I041821-03 25 mg

Idarubicin Impurity 21

Sign In for Pricing
View Details
Idarubicin Impurity 21
RM-I041821-04 50 mg

Idarubicin Impurity 21

Sign In for Pricing
View Details
PE/iFluor® 750 Anti-human CD140b Antibody *18A2*
114011Q1-AAT 100 Tests

PE/iFluor® 750 Anti-human CD140b Antibody *18A2*

Sign In for Pricing
View Details
Rabbit anti-Escherichia coli O139:H28 (strain E24377A/ETEC) YQHA Polyclonal Antibody
MBS7169922 Inquire

Rabbit anti-Escherichia coli O139:H28 (strain E24377A/ETEC) YQHA Polyclonal Antibody

Sign In for Pricing
View Details